General Information

    • DRAMP ID

    • DRAMP00352

    • Peptide Name

    • Non-specific lipid-transfer protein A (NS-LTP A; PLTP; Plants)

    • Source

    • Ricinus communis (Castor bean)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAIN

    • Sequence Length

    • 92

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00352 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00352.

Physicochemical Information

    • Formula

    • C393H658N116O128S8

    • Absent Amino Acids

    • HMWY

    • Common Amino Acids

    • A

    • Mass

    • 9312.73

    • PI

    • 8.72

    • Basic Residues

    • 9

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 34

    • Net Charge

    • +4

    • Boman Index

    • -97.24

    • Hydrophobicity

    • 0.157

    • Aliphatic Index

    • 82.93

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 5.49

    • Polar Residues

    • 34

DRAMP00352

DRAMP00352 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The amino-acid sequence of the nonspecific lipid transfer protein from germinated castor bean endosperms.

    • Reference

    • Biochim. Biophys. Acta 1986;870:248-255.

    • Author

    • Takishima K, Watanabe S, Yamada M, Mamiya G.