General Information

    • DRAMP ID

    • DRAMP00354

    • Peptide Name

    • Non-specific lipid-transfer protein C, cotyledon-specific isoform (NS-LTP C; PLTP; Plants)

    • Source

    • Ricinus communis (Castor bean)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • AVPCSTVDMKAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNIKVGFPVSTNTNCETIH

    • Sequence Length

    • 92

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00354 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00354.

Physicochemical Information

    • Formula

    • C410H686N116O129S9

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • AK

    • Mass

    • 9593.2

    • PI

    • 9.01

    • Basic Residues

    • 13

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +7

    • Boman Index

    • -102.8

    • Hydrophobicity

    • 0.011

    • Aliphatic Index

    • 76.41

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 5.49

    • Polar Residues

    • 32

DRAMP00354

DRAMP00354 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Organ-specific occurrence and expression of the isoforms of nonspecific lipid transfer protein in castor bean seedlings, and molecular cloning of a full-length cDNA for a cotyledon-specific isoform.

    • Reference

    • J Biochem. 1991 Nov;110(5):823-831.

    • Author

    • Tsuboi S, Suga T, Takishima K, Mamiya G, Matsui K, Ozeki Y, Yamada M.