• DRAMP ID

    • DRAMP00355
    • Peptide Name

    • Non-specific lipid-transfer protein D, cotyledon-specific isoform (NS-LTP D; Plants)
    • Source

    • Ricinus communis (Castor bean)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • Not found
    • Sequence

    • AVPCSTVDMKAAACVGFATGKDSKPSSACCTGLQQLAQTVKSVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNIKVGFPVSTATNCETIH
    • Sequence Length

    • 92
    • Protein Existence

    • Homology
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00355 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00355.
    • Formula

    • C406H680N114O128S9
    • Absent Amino Acids

    • WY
    • Common Amino Acids

    • AK
    • Mass

    • 9495.09
    • PI

    • 9.01
    • Basic Residues

    • 13
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 32
    • Net Charge

    • +7
    • Boman Index

    • -93.04
    • Hydrophobicity

    • 0.097
    • Aliphatic Index

    • 77.5
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 500
    • Absorbance 280nm

    • 5.49
    • Polar Residues

    • 32

DRAMP00355

DRAMP00355 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • The lipid-transfer protein C of Ricinus communis L.: isolation of two cDNA sequences which are strongly and exclusively expressed in cotyledons after germination.
    • Reference

    • Planta 1992;187:367-371.
    • Author

    • Weig A, Komor E.