General Information

    • DRAMP ID

    • DRAMP00356

    • Peptide Name

    • Non-specific lipid-transfer protein (LTP; PLTP; Plants)

    • Source

    • Spinacia oleracea (Spinach)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • GITCGMVSSKLAPCIGYLKGGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAVH

    • Sequence Length

    • 91

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00356 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00356.

Physicochemical Information

    • Formula

    • C379H625N111O113S10

    • Absent Amino Acids

    • EFQW

    • Common Amino Acids

    • GA

    • Mass

    • 8865.41

    • PI

    • 9.16

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +9

    • Boman Index

    • -11.46

    • Hydrophobicity

    • 0.288

    • Aliphatic Index

    • 80.66

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 55.22

    • Polar Residues

    • 42

DRAMP00356

DRAMP00356 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Isolation of a cDNA Clone for Spinach Lipid Transfer Protein and Evidence that the Protein Is Synthesized by the Secretory Pathway.

    • Reference

    • Plant Physiol. 1991 Jan;95(1):164-170.

    • Author

    • Bernhard WR, Thoma S, Botella J, Somerville CR.
  • ·Literature 2

    • Title

    • The primary structure of spinach-leaf phospholipid-transfer protein.

    • Reference

    • Eur J Biochem. 1987 Jul 15;166(2):387-391.

    • Author

    • Bouillon P, Drischel C, Vergnolle C, Duranton H, Kader JC.