General Information

    • DRAMP ID

    • DRAMP00357

    • Peptide Name

    • Non-specific lipid-transfer protein 1 (LTP 1; Plants)

    • Source

    • Sorghum bicolor (Sorghum) (Sorghum vulgare)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP1

    • Sequence

    • TTSEAAISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVS

    • Sequence Length

    • 98

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00357 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00357.

Physicochemical Information

    • Formula

    • C396H662N128O138S8

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • AS

    • Mass

    • 9680.87

    • PI

    • 9.12

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 33

    • Net Charge

    • +6

    • Boman Index

    • -138.29

    • Hydrophobicity

    • 0.124

    • Aliphatic Index

    • 71.94

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 35.88

    • Polar Residues

    • 48

DRAMP00357

DRAMP00357 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • A pair of genes coding for lipid-transfer proteins in Sorghum vulgare.

    • Reference

    • Gene. 1994 Oct 21;148(2):305-308.

    • Author

    • Pel¨se-Siebenbourg F, Caelles C, Kader JC, Delseny M, Puigdom¨nech P.