• DRAMP ID

    • DRAMP00358
    • Peptide Name

    • Non-specific lipid-transfer protein 2 (LTP 2; Plants)
    • Source

    • Sorghum bicolor (Sorghum) (Sorghum vulgare)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • LTP2
    • Sequence

    • ATTSEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRVS
    • Sequence Length

    • 99
    • Protein Existence

    • Homology
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00358 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00358.
    • Formula

    • C398H674N132O138S8
    • Absent Amino Acids

    • FHMW
    • Common Amino Acids

    • SA
    • Mass

    • 9773.01
    • PI

    • 9.45
    • Basic Residues

    • 11
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 30
    • Net Charge

    • +8
    • Boman Index

    • -156.89
    • Hydrophobicity

    • -0.011
    • Aliphatic Index

    • 68.18
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 35.51
    • Polar Residues

    • 49

DRAMP00358

DRAMP00358 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • A pair of genes coding for lipid-transfer proteins in Sorghum vulgare.
    • Reference

    • Gene. 1994 Oct 21;148(2):305-308.
    • Author

    • Pel¨se-Siebenbourg F, Caelles C, Kader JC, Delseny M, Puigdom¨nech P.