General Information

    • DRAMP ID

    • DRAMP00359

    • Peptide Name

    • Non-specific lipid-transfer protein (LTP; PLTP; Plants)

    • Source

    • Zea mays (Maize)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN

    • Sequence Length

    • 93

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (6 helices; 53 residues)

    • Structure Description

    • The global fold involving four helical fragments connected by three loops and a C-terminal tail without regular secondary structures is stabilized by four disulfide bridges. The most striking feature of this structure is the existence of an internal hydrophobic cavity running through the whole molecule. (Ref.3)

    • Helical Wheel Diagram

    • DRAMP00359 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00359.

Physicochemical Information

    • Formula

    • C368H616N122O128S8

    • Absent Amino Acids

    • EFHMW

    • Common Amino Acids

    • A

    • Mass

    • 9054.16

    • PI

    • 9.12

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +6

    • Boman Index

    • -121.46

    • Hydrophobicity

    • 0.097

    • Aliphatic Index

    • 71.61

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 37.83

    • Polar Residues

    • 46

DRAMP00359

DRAMP00359 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • Allergenic properties

    • Causes an allergic reaction in human.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Multiple mRNA coding for phospholipid-transfer protein from Zea mays arise from alternative splicing.

    • Reference

    • Gene. 1991 Mar 1;99(1):133-136.

    • Author

    • Arondel V, Tchang F, Baillet B, Vignols F, Grellet F, Delseny M, Kader JC, Puigdom¨nech P.
  • ·Literature 2

    • Title

    • High-resolution crystal structure of the non-specific lipid-transfer protein from maize seedlings.

    • Reference

    • Structure. 1995 Feb 15;3(2):189-199.

    • Author

    • Shin DH, Lee JY, Hwang KY, Kim KK, Suh SW.
  • ·Literature 3

    • Title

    • Solution structure and lipid binding of a nonspecific lipid transfer protein extracted from maize seeds.

    • Reference

    • Protein Sci. 1996 Apr;5(4):565-577.

    • Author

    • Gomar J, Petit MC, Sodano P, Sy D, Marion D, Kader JC, Vovelle F, Ptak M.