General Information

    • DRAMP ID

    • DRAMP00362

    • Peptide Name

    • Non-specific lipid-transfer protein 1 (Lc-LTP1; Plants)

    • Source

    • Lens culinaris (Lentil) (Cicer lens)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • AISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIRF

    • Sequence Length

    • 93

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00362 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00362.

Physicochemical Information

    • Formula

    • C397H668N122O122S8

    • Absent Amino Acids

    • EHMW

    • Common Amino Acids

    • G

    • Mass

    • 9358.89

    • PI

    • 9.7

    • Basic Residues

    • 11

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 27

    • Net Charge

    • +10

    • Boman Index

    • -94.66

    • Hydrophobicity

    • 0.082

    • Aliphatic Index

    • 78.71

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 37.83

    • Polar Residues

    • 46

DRAMP00362

DRAMP00362 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds 4-51; 14-28; 29-74; 49-88.

Literature Information

  • ·Literature 1

    • Title

    • Purification and primary structure of novel lipid transfer proteins from germinated lentil (Lens culinaris) seeds.

    • Reference

    • Biochemistry (Mosc). 2007 Apr;72(4):430-438.

    • Author

    • Finkina EI, Balandin SV, Serebryakova MV, Potapenko NA, Tagaev AA, Ovchinnikova TV.