• DRAMP ID

    • DRAMP00368
    • Peptide Name

    • Non-specific lipid-transfer protein 8 (Lc-LTP8; Plants)
    • Source

    • Lens culinaris (Lentil) (Cicer lens)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • Not found
    • Sequence

    • AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK
    • Sequence Length

    • 92
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00368 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00368.
    • Formula

    • C385H644N112O127S8
    • Absent Amino Acids

    • EFHMW
    • Common Amino Acids

    • A
    • Mass

    • 9130.5
    • PI

    • 9.03
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +6
    • Boman Index

    • -72.97
    • Hydrophobicity

    • 0.024
    • Aliphatic Index

    • 76.52
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 38.24
    • Polar Residues

    • 45

DRAMP00368

DRAMP00368 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
    • PTM

    • Contains four disulfide bonds 4-51; 14-28; 29-74; 49-88.
  • ·Literature 1
    • Title

    • Purification and primary structure of novel lipid transfer proteins from germinated lentil (Lens culinaris) seeds.
    • Reference

    • Biochemistry (Mosc). 2007 Apr;72(4):430-438.
    • Author

    • Finkina EI, Balandin SV, Serebryakova MV, Potapenko NA, Tagaev AA, Ovchinnikova TV.