General Information

    • DRAMP ID

    • DRAMP00371

    • Peptide Name

    • Non-specific lipid-transfer protein (LTP; Plant defensin)

    • Source

    • Lycium barbarum (Matrimony vine)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • GPLGGCCGGIKKSAAAGISGINYGIAAGLPGKCGVNIPYKISPSTDCSKVQ

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00371 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00371.

Physicochemical Information

    • Formula

    • C211H349N59O65S4

    • Absent Amino Acids

    • EFHMRW

    • Common Amino Acids

    • G

    • Mass

    • 4880.69

    • PI

    • 9.1

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -3.19

    • Hydrophobicity

    • 0.204

    • Aliphatic Index

    • 82.35

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 64.6

    • Polar Residues

    • 25

DRAMP00371

DRAMP00371 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

    • Miscellaneous

    • Causes an allergic reaction.

Literature Information

  • ·Literature 1

    • Title

    • Allergic sensitization to Goji berries is mediated by a 7 kDa band (LTP).

    • Reference

    • Submitted (SEP-2011) to UniProtKB

    • Author

    • Carnes J, Lopez-matas M.A, Saez R.