General Information

    • DRAMP ID

    • DRAMP00374

    • Peptide Name

    • Non-specific lipid-transfer protein 6 (LTP 6; Plants)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP6

    • Sequence

    • AVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSIQ

    • Sequence Length

    • 94

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00374 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00374.

Physicochemical Information

    • Formula

    • C424H696N116O138S8

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • LST

    • Mass

    • 9883.36

    • PI

    • 7.71

    • Basic Residues

    • 7

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +1

    • Boman Index

    • -97.15

    • Hydrophobicity

    • 0.084

    • Aliphatic Index

    • 89.15

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 53.44

    • Polar Residues

    • 40

DRAMP00374

DRAMP00374 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). Their biological Function

Literature Information

  • ·Literature 1

    • Title

    • Lipid transfer proteins are encoded by a small multigene family in Arabidopsis thaliana.

    • Reference

    • Plant Sci. 2000 Aug 8;157(1):1-12.

    • Author

    • Arondel12 V V, Vergnolle2 C, Cantrel C, Kader J.