General Information

    • DRAMP ID

    • DRAMP00381

    • Peptide Name

    • IWF4 (Plants)

    • Source

    • Beta vulgaris (Sugar beet)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SGECNMYGRCPPGYCCSKFGYCGGVRAYCG

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Cercospora beticola (IC50<2 µg/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00381 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00381.

Physicochemical Information

    • Formula

    • C133H194N38O40S7

    • Absent Amino Acids

    • DHILQTW

    • Common Amino Acids

    • G

    • Mass

    • 3189.65

    • PI

    • 8.27

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 3

    • Net Charge

    • +2

    • Boman Index

    • -30.76

    • Hydrophobicity

    • -0.233

    • Aliphatic Index

    • 13

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 218.45

    • Polar Residues

    • 20

DRAMP00381

DRAMP00381 chydropathy plot

Comments Information

    • Tissue specificity

    • IWF4 mRNA is expressed in the aerial parts of the plant only, with a constitutive expression in young and mature leaves and in young flowers.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of a new antifungal chitin-binding peptide from sugar beet leaves.

    • Reference

    • Plant Physiol. 1997 Jan;113(1):83-91.

    • Author

    • Nielsen KK, Nielsen JE, Madrid SM, Mikkelsen JD.