General Information

    • DRAMP ID

    • DRAMP00383

    • Peptide Name

    • Antimicrobial peptide 1 (Mc-AMP1; knottin-type peptide; Plant defensin)

    • Source

    • Mesembryanthemum crystallinum (Common ice plant) (Cryophytum crystallinum)

    • Family

    • Belongs to the AMP family

    • Gene

    • Not found

    • Sequence

    • AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR

    • Sequence Length

    • 38

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus megaterium (IC50=2 µg/mL), Sarcina lutea (IC50=50 µg/mL).
      • Fungi: Alternaria brassicola (IC50=6 µg/mL), Ascochyta pisi (IC50=6 µg/mL), Botrytis cinerea (IC50=2 µg/mL), Cercospora beticola (IC50=2 µg/mL), Colletotrichum lindemuthianum (IC50=1 µg/mL), Fusarium culmorum (IC50=3 µg/mL), Fusarium oxysporum f. sp. Pisi (IC50=5 µg/mL), Fusarium oxysporum f. sp. Lycopersici (IC50=10 µg/mL), Nectria haematococca (IC50=0.5 µg/mL), Phoma betae (IC50=6 µg/mL), Pyrenophora tritici-repentis (IC50=20 µg/mL), Pyricularia oryzae (IC50=0.5 µg/mL), Rhizoctonia solani (IC50=15 µg/mL), Verticiliium dahliae (IC50=0.5 µg/mL), Venturia inaequalis (IC50=1 µg/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00383 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00383.

Physicochemical Information

    • Formula

    • C182H281N59O50S6

    • Absent Amino Acids

    • HLMT

    • Common Amino Acids

    • CG

    • Mass

    • 4287.96

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +6

    • Boman Index

    • -91.26

    • Hydrophobicity

    • -0.832

    • Aliphatic Index

    • 23.16

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 239.32

    • Polar Residues

    • 17

DRAMP00383

DRAMP00383 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal and antibacterial activity.

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds 3-20; 10-24; 18-35.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptide 1 from the common ice plant.

    • Reference

    • Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Michalowski C.B, Bohnert H.J.