General Information

    • DRAMP ID

    • DRAMP00392

    • Peptide Name

    • Antimicrobial peptide 1 (ToAMP1; Cys-rich; Plant defensin)

    • Source

    • Taraxacum officinale (Common dandelion) (Leontodon taraxacum)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VAKCTEESGGKYFVFCCYKPTRICYMNEQKCESTCIGK

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=5.8 µM), Aspergillus niger (IC50=5.6 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00392 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00392.

Physicochemical Information

    • Formula

    • C187H292N48O57S7

    • Absent Amino Acids

    • DHLW

    • Common Amino Acids

    • C

    • Mass

    • 4349.08

    • PI

    • 8.29

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +2

    • Boman Index

    • -58.48

    • Hydrophobicity

    • -0.361

    • Aliphatic Index

    • 38.42

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 130.95

    • Polar Residues

    • 18

DRAMP00392

DRAMP00392 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity. Also active against bacterial species P. syringae, B. subtilis and X. campestris.

    • Tissue specificity

    • Expressed in flowers but not in leaves, seeds or roots (at protein level).

Literature Information

  • ·Literature 1

    • Title

    • Discovery of novel antimicrobial peptides with unusual cysteine motifs in dandelion Taraxacum officinale Wigg. flowers.

    • Reference

    • Peptides. 2012 Aug;36(2):266-271.

    • Author

    • Astafieva AA, Rogozhin EA, Odintsova TI, Khadeeva NV, Grishin EV, Egorov TsA.