General Information

    • DRAMP ID

    • DRAMP00395

    • Peptide Name

    • Cyclotide vitri-A (Vbc6; Plant defensin)

    • Source

    • Viola biflora (Yellow wood violet)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVWIPCITSAIGCSCKSKVCYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Ref.20580652] HD50=8.91 µM against human type O red blood cells.

    • Cytotoxicity

      • [Ref.14987049] Cytotoxicity: U-937 GTB (lymphoma)(IC50 = 0.6 µM) and RPMI-8226/s (myeloma)(IC50 = 1 µM).
      • [Ref.20580652] Cytotoxicity: U251(IC50 = 6.03 μg/mL), MDA-MB-231(IC50 = 3.69 μg/mL), A549(IC50 = 3.90 μg/mL), DU145(IC50 = 3.07 μg/mL), BEL-7402(IC50 = 4.94 μg/mL).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys 4 and Cys20, Cys8 and Cys22, Cys13 and Cys27 .

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00395 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00395.

Physicochemical Information

    • Formula

    • C134H217N37O40S6

    • Absent Amino Acids

    • DFHLMQ

    • Common Amino Acids

    • C

    • Mass

    • 3178.78

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -13.38

    • Hydrophobicity

    • 0.447

    • Aliphatic Index

    • 74.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 16

DRAMP00395

DRAMP00395 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Problely contains three disulfide bonds 4-20; 8-22; 13-27. This is a cyclic peptide.

Literature Information

  • ·Literature 1

    • Title

    • The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.

    • Reference

    • Phytochemistry. 2008 Feb;69(4):939-952.

    • Author

    • Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Göransson U.