General Information

    • DRAMP ID

    • DRAMP00396

    • Peptide Name

    • Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; Plant defensin)

    • Source

    • Clitoria ternatea

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC

    • Sequence Length

    • 49

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacterium: Bacillus subtilis (IC50=15 µg/mL).
      • Medium A: Botrytis cinerea (IC50=20 µg/ml), Cladosporium sphaerospermum (IC50=6 µg/ml), Fusarium culmorum (IC50=10 µg/ml), Leptosphaeria maculans (IC50=6 µg/ml), Penicillium digitatum (IC50=20 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=2 µg/ml), Verticilium albo-atrum (IC50=2 µg/ml). NOTE: Medium B = 1/2 strength potato dextrose broth.
      • Medium B: Botrytis cinerea (IC50>100 µg/ml), Cladosporium sphaerospermum (IC50=100 µg/ml), Fusarium culmorum (IC50=50 µg/ml), Leptosphaeria maculans (IC50=20 µg/ml), Penicillium digitatum (IC50=80 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=80 µg/ml), Verticilium albo-atrum (IC50>100 µg/ml).
      • NOTE: Medium B = Medium A supplemented with 1 mM CaCl2 and 50 mM KCI.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00396 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00396.

Physicochemical Information

    • Formula

    • C234H344N76O71S8

    • Absent Amino Acids

    • IMPV

    • Common Amino Acids

    • C

    • Mass

    • 5614.25

    • PI

    • 8.21

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -119.25

    • Hydrophobicity

    • -0.849

    • Aliphatic Index

    • 22.04

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18490

    • Absorbance 280nm

    • 385.21

    • Polar Residues

    • 25

DRAMP00396

DRAMP00396 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

    • Reference

    • FEBS Lett. 1995 Jul 17;368(2):257-262.

    • Author

    • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.