• • DRAMP ID

  • DRAMP00397

• • Peptide Name

  • Defensin D1 (Ns-D1; Plant defensin)

• • Source

  • Nigella sativa (Black cumin)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC

• • Sequence Length

  • 50

• • UniProt Entry

  • P86972

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Fungi: Aspergillus niger (IC50=3.5 µg/ml), Bipolaris sorokiniana (IC50=3.0 µg/ml), Fusarium oxysporum (IC50=9.5 µg/ml), Fusarium graminearum (IC50=6.9 µg/ml), Fusarium culmorum (IC50=6.9 µg/ml) and Botrytis cinerea (IC50=27.4 µg/ml).
    • Gram-positive bacteria: Clavibacter michiganensis (1.4 cm) and Bacillus subtilis (1.3 cm);
    • Gram-negative bacteria: Pseudomonas syringae (0.9 cm), Erwinia carotovora (0.7 cm) and Escherichia coli (1.2 cm).
    • NOTE: Inhibition zone; Defensin concentration (11 µg in 50 μl).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00397.

DRAMP00397

• • Function

  • Antimicrobial peptide active against fungi, Gram-positive and Gram-negative bacteria. Has no effect on spore germination. Destroys spores in germinated conidia by disruption of cell walls and membranes in A. niger and B. sorokiniana. Causes vacuolization of germinated macro- and microconidia in F. oxysporum, F. graminearum and F. culmorum. Strongly inhibits growth of P. infestans on potato tubers above concentrations of 13.6 µg/ml.

• • PTM

  • Contains four disulfide bonds.

• ·Literature 1

• • Title

  • Novel antifungal defensins from Nigella sativa L. seeds.

• • Pubmed ID

  • 21144761

• • Reference

  • Plant Physiol Biochem. 2011 Feb;49(2):131-137.

• • Author

  • Rogozhin EA, Oshchepkova YI, Odintsova TI, Khadeeva NV, Veshkurova ON, Egorov TA, Grishin EV, Salikhov SI.