• • DRAMP ID

  • DRAMP00398

• • Peptide Name

  • Defensin D2 (Ns-D2; Plant defensin)

• • Source

  • Nigella sativa (Black cumin)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC

• • Sequence Length

  • 50

• • UniProt Entry

  • P86973

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Fungi: Aspergillus niger (IC50=3.5 µg/ml), Bipolaris sorokiniana (IC50=1.8 µg/ml), Fusarium oxysporum (IC50=5.3 µg/ml), Fusarium graminearum (IC50=6.9 µg/ml), Fusarium culmorum (IC50=6.9 µg/ml) and Botrytis cinerea (IC50=13.7 µg/ml).
    • Gram-positive bacteria: Clavibacter michiganensis (1.5 cm) and Bacillus subtilis (1.3 cm);
    • Gram-negative bacteria: Pseudomonas syringae (1.3 cm), Erwinia carotovora (0.7 cm) and Escherichia coli (1.4 cm).
    • NOTE: Inhibition zone; Defensin concentration (11 µg in 50 μl).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00398.

DRAMP00398

• • Function

  • Antimicrobial peptide active against fungi, Gram-positive and Gram-negative bacteria. Has no effect on spore germination. Destroys spores in germinated conidia by disruption of cell walls and membranes in Aspergillus niger and B.sorokiniana. Causes vacuolization of germinated macro- and microconidia in Fusarium oxysporum, F.graminearum and F.culmorum. Strongly inhibits growth of P.infestans on potato tubers above concentrations of 3.4 µg/ml.

• • PTM

  • Contains four disulfide bonds.

• ·Literature 1

• • Title

  • Novel antifungal defensins from Nigella sativa L. seeds.

• • Pubmed ID

  • 21144761

• • Reference

  • Plant Physiol Biochem. 2011 Feb;49(2):131-137.

• • Author

  • Rogozhin EA, Oshchepkova YI, Odintsova TI, Khadeeva NV, Veshkurova ON, Egorov TA, Grishin EV, Salikhov SI.