• DRAMP ID

    • DRAMP00398
    • Peptide Name

    • Defensin D2 (Ns-D2; Plant defensin)
    • Source

    • Nigella sativa (Black cumin)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC
    • Sequence Length

    • 50
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Fungi: Aspergillus niger (IC50=3.5 µg/ml), Bipolaris sorokiniana (IC50=1.8 µg/ml), Fusarium oxysporum (IC50=5.3 µg/ml), Fusarium graminearum (IC50=6.9 µg/ml), Fusarium culmorum (IC50=6.9 µg/ml) and Botrytis cinerea (IC50=13.7 µg/ml).
      • Gram-positive bacteria: Clavibacter michiganensis (1.5 cm) and Bacillus subtilis (1.3 cm);
      • Gram-negative bacteria: Pseudomonas syringae (1.3 cm), Erwinia carotovora (0.7 cm) and Escherichia coli (1.4 cm).
      • NOTE: Inhibition zone; Defensin concentration (11 µg in 50 μl).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00398 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00398.
    • Formula

    • C233H359N69O70S8
    • Absent Amino Acids

    • M
    • Common Amino Acids

    • C
    • Mass

    • 5503.31
    • PI

    • 8.48
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +5
    • Boman Index

    • -81.13
    • Hydrophobicity

    • -0.494
    • Aliphatic Index

    • 43
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 213.67
    • Polar Residues

    • 24

DRAMP00398

DRAMP00398 chydropathy plot
    • Function

    • Antimicrobial peptide active against fungi, Gram-positive and Gram-negative bacteria. Has no effect on spore germination. Destroys spores in germinated conidia by disruption of cell walls and membranes in Aspergillus niger and B.sorokiniana. Causes vacuolization of germinated macro- and microconidia in Fusarium oxysporum, F.graminearum and F.culmorum. Strongly inhibits growth of P.infestans on potato tubers above concentrations of 3.4 µg/ml.
    • PTM

    • Contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Novel antifungal defensins from Nigella sativa L. seeds.
    • Reference

    • Plant Physiol Biochem. 2011 Feb;49(2):131-137.
    • Author

    • Rogozhin EA, Oshchepkova YI, Odintsova TI, Khadeeva NV, Veshkurova ON, Egorov TA, Grishin EV, Salikhov SI.