• DRAMP ID

    • DRAMP00399
    • Peptide Name

    • Defensin-like protein 39 (Disease resistance response protein 39; Plant defensin)
    • Source

    • Pisum sativum (Garden pea)
    • Family

    • Belongs to the DEFL family
    • Gene

    • PI39
    • Sequence

    • NTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHDWKCFCTQNC
    • Sequence Length

    • 46
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00399 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00399.
    • Formula

    • C214H322N66O70S8
    • Absent Amino Acids

    • MP
    • Common Amino Acids

    • C
    • Mass

    • 5195.79
    • PI

    • 6.42
    • Basic Residues

    • 8
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +3
    • Boman Index

    • -99.15
    • Hydrophobicity

    • -0.539
    • Aliphatic Index

    • 38.26
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 166.44
    • Polar Residues

    • 22

DRAMP00399

DRAMP00399 chydropathy plot
    • Function

    • Possesses antifungal activity (By similarity).
    • Tissue specificity

    • Pods.
    • Induction

    • Upon contact with the plant pathogen fungus Fusarium solani.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • The Fusarium solani-induced expression of a pea gene family encoding high cysteine content proteins.
    • Reference

    • Mol Plant Microbe Interact. 1991 Jul-Aug;4(4):324-331.
    • Author

    • Chiang CC, Hadwiger LA.