General Information

    • DRAMP ID

    • DRAMP00400

    • Peptide Name

    • Defensin-like protein 1 (Defensin AMP1, CtAMP1; Plant defensin)

    • Source

    • Clitoria ternatea (Butterfly pea)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=20 µg/ml), Cladosporium sphaerospermum (IC50=6 µg/ml), Fusarium culmorum (IC50=10 µg/ml), Leptosphaeria maculans (IC50=6 µg/ml), Penicillium digitatum (IC50=20 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=2 µg/ml), Verticilium albo-atrum (IC50=2 µg/ml), Neurospora crassa (IC50<0.3 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • fungal plasma membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00400 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00400.

Physicochemical Information

    • Formula

    • C234H345N77O70S8

    • Absent Amino Acids

    • IMPV

    • Common Amino Acids

    • C

    • Mass

    • 5613.27

    • PI

    • 8.51

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -117.17

    • Hydrophobicity

    • -0.849

    • Aliphatic Index

    • 22.04

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18490

    • Absorbance 280nm

    • 385.21

    • Polar Residues

    • 26

DRAMP00400

DRAMP00400 chydropathy plot

Comments Information

    • Function

    • Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

    • Reference

    • FEBS Lett. 1995 Jul 17;368(2):257-262.

    • Author

    • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.
  • ·Literature 2

    • Title

    • Specific binding sites for an antifungal plant defensin from Dahlia (Dahlia merckii) on fungal cells are required for antifungal activity.

    • Reference

    • Mol Plant Microbe Interact. 2000 Jan;13(1):54-61.

    • Author

    • Thevissen K, Osborn RW, Acland DP, Broekaert WF.