General Information

    • DRAMP ID

    • DRAMP00401

    • Peptide Name

    • Defensin-like protein 2 (MTI-2; Trypsin inhibitor 2; Plant defensin)

    • Source

    • Sinapis alba (White mustard) (Brassica hirta)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • DSECLKEYGGDVGFPFCAPRIFPTICYTRCRENKGAKGGRCIWGEGTNVKCLCDYCNDSPFDQ

    • Sequence Length

    • 63

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00401 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00401.

Physicochemical Information

    • Formula

    • C303H456N84O94S8

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • CG

    • Mass

    • 7035.94

    • PI

    • 5.17

    • Basic Residues

    • 8

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 14

    • Net Charge

    • -1

    • Boman Index

    • -124.8

    • Hydrophobicity

    • -0.522

    • Aliphatic Index

    • 43.33

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 168.87

    • Polar Residues

    • 27

DRAMP00401

DRAMP00401 chydropathy plot

Comments Information

    • Function

    • Inhibits bovine beta-trypsin and alpha-chymotrypsin on a 1

    • PTM

    • Problely contains four disulfide bonds 4-56; 17-41; 26-51; 30-53.

Literature Information

  • ·Literature 1

    • Title

    • The gene coding for the mustard trypsin inhibitor-2 is discontinuous and wound-inducible.

    • Reference

    • FEBS Lett. 1995 May 8;364(2):179-181.

    • Author

    • Ceci LR, Spoto N, de Virgilio M, Gallerani R.
  • ·Literature 2

    • Title

    • Purification, inhibitory properties and amino acid sequence of a new serine proteinase inhibitor from white mustard (Sinapis alba L.) seed.

    • Reference

    • FEBS Lett. 1992 Apr 13;301(1):10-14.

    • Author

    • Menegatti E, Tedeschi G, Ronchi S, Bortolotti F, Ascenzi P, Thomas RM, Bolognesi M, Palmieri S.