General Information

    • DRAMP ID

    • DRAMP00403

    • Peptide Name

    • Defensin D2 (So-D2; Antimicrobial peptide D2; Plant defensin)

    • Source

    • Spinacia oleracea (Spinach)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC

    • Sequence Length

    • 52

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacterium: Clavibacter michiganensis;
      • Gram-negative bacterium: Ralstonia solanacearum.
      • Fungi: Fusarium culmorum.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00403 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00403.

Physicochemical Information

    • Formula

    • C238H391N77O74S9

    • Absent Amino Acids

    • HLQVW

    • Common Amino Acids

    • C

    • Mass

    • 5803.73

    • PI

    • 9.35

    • Basic Residues

    • 12

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +8

    • Boman Index

    • -153.57

    • Hydrophobicity

    • -0.81

    • Aliphatic Index

    • 24.42

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 68.24

    • Polar Residues

    • 26

DRAMP00403

DRAMP00403 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide. Active against Fusarium spp., Gram-positive and Gram-negative bacterial pathogens.

    • Tissue specificity

    • Distributed in the epidermal cell layer of leaves and in the subepidermal layer region of stems. Not in roots.

    • Developmental stage

    • Present throughout the life of the leaf.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Novel defensin subfamily from spinach (Spinacia oleracea).

    • Reference

    • FEBS Lett. 1998; 435: 159-162.

    • Author

    • Segura A, Moreno M, Molina A, Garc­a-Olmedo F.