General Information

    • DRAMP ID

    • DRAMP00410

    • Peptide Name

    • Defensin-like protein 1 (Bn-AFP1; Plant defensin)

    • Source

    • Brassica napus (Rape)

    • Family

    • Belongs to the DEFL family

    • Gene

    • AFP1

    • Sequence

    • QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHK

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (IC50=3 µg/ml), Botrytis cinerea (IC50=1.50 µg/ml), Fusarium culmorum (IC50=2 µg/ml), Fusarium oxysporum f.sp.lycopersici (IC50=1.80 µg/ml), Pyricularia oryzae (IC50=0.25 µg/ml), Verticiliium dahliae (IC50=0.80 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00410 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00410.

Physicochemical Information

    • Formula

    • C204H321N67O62S5

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • N

    • Mass

    • 4864.5

    • PI

    • 9.02

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -95.07

    • Hydrophobicity

    • -0.793

    • Aliphatic Index

    • 46.59

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 168.37

    • Polar Residues

    • 20

DRAMP00410

DRAMP00410 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity sensitive to inorganic cations.

    • Subunit structure

    • Forms oligomers in its native state.

    • PTM

    • Problely contains one disulfide bond.

Literature Information

  • ·Literature 1

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.