General Information

    • DRAMP ID

    • DRAMP00416

    • Peptide Name

    • Raphanus sativus Antifungal Protein 3 (Rs-AFP3; Plant defensin)

    • Source

    • Raphanus sativus (Radish) & Brassica napus (Rape)

    • Family

    • Belongs to the DEFL family

    • Gene

    • AFP3

    • Sequence

    • KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 50

    • Protein Existence

    • Protein inferred from homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicicola (MIC=2 µg/ml), Botrytis cinerea (MIC=2 µg/ml), Fusarium culmorum (MIC=2 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys3 and Cys50, Cys14 and Cys35, Cys20 and Cys44, Cys24 and Cys51.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00416 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00416.

Physicochemical Information

    • Formula

    • C232H355N71O69S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5499.28

    • PI

    • 8.51

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -73.74

    • Hydrophobicity

    • -0.304

    • Aliphatic Index

    • 48.8

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 183.27

    • Polar Residues

    • 25

DRAMP00416

DRAMP00416 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity sensitive to inorganic cations (By similarity).

    • PTM

    • Problely contains four disulfide bonds 3-50; 14-35; 20-44; 24-46.

Literature Information

  • ·Literature 1

    • Title

    • Small cysteine-rich antifungal proteins from radish: their role in host defense.

    • Reference

    • Plant Cell. 1995 May;7(5):573-588.

    • Author

    • Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al.
  • ·Literature 2

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.