• DRAMP ID

    • DRAMP00416
    • Peptide Name

    • Raphanus sativus Antifungal Protein 3 (Rs-AFP3; Plant defensin)
    • Source

    • Raphanus sativus (Radish) & Brassica napus (Rape)
    • Family

    • Belongs to the DEFL family
    • Gene

    • AFP3
    • Sequence

    • KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC
    • Sequence Length

    • 50
    • Evidence code

    • Homology
    • Biological Activity

    • Antifungal
    • Target Organism

      • Fungi: Alternaria brassicicola (MIC=2 µg/ml), Botrytis cinerea (MIC=2 µg/ml), Fusarium culmorum (MIC=2 µg/ml).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Bridge
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00416 helical wheel diagram
    • Formula

    • C232H355N71O69S8
    • Absent Amino Acids

    • DM
    • Common Amino Acids

    • C
    • Mass

    • 6373.49
    • PI

    • 8.21
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -73.74
    • Hydrophobicity

    • -30.4
    • Aliphatic Index

    • 48.8
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 183.27
    • Polar Residues

    • 25

Amino Acid Distribution

DRAMP00416 chydropathy plot
    • Function

    • Possesses antifungal activity sensitive to inorganic cations (By similarity).
    • PTM

    • Problely contains four disulfide bonds 3-50; 14-35; 20-44; 24-46.
  • Literature 1
    • Reference

    • Plant Cell. 1995 May;7(5):573-588.
    • Author

    • Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al.
    • Title

    • Small cysteine-rich antifungal proteins from radish: their role in host defense.
  • Literature 2
    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.
    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.