• DRAMP ID

    • DRAMP00417
    • Peptide Name

    • Raphanus sativus Antifungal Protein 4 (Rs-AFP4; Plant defensin)
    • Source

    • Raphanus sativus (Radish)
    • Family

    • Belongs to the DEFL family
    • Gene

    • AFP4
    • Sequence

    • QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
    • Sequence Length

    • 51
    • Evidence code

    • Homology
    • Biological Activity

    • Antifungal
    • Target Organism

      • Fungi: Alternaria brassicicola (MIC=5 µg/ml), Botrytis cinerea (MIC=9 µg/ml), Fusarium culmorum (MIC=11 µg/ml).
    • Binding Traget

    • Unknow
    • Structure

    • Bridge
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00417 helical wheel diagram
    • Formula

    • C243H367N75O72S8
    • Absent Amino Acids

    • DM
    • Common Amino Acids

    • C
    • Mass

    • 6639.56
    • PI

    • 8.21
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -90.82
    • Hydrophobicity

    • -43.33
    • Aliphatic Index

    • 47.84
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 209.4
    • Polar Residues

    • 27
browser doesn't support html5

Amino Acid Distribution

DRAMP00417 chydropathy plot
    • PTM

    • Contains four disulfide bonds 4-51;15-36;21-45;25-47, and Pyrrolidone carboxylic acid at position 1.
  • Literature 1
    • Reference

    • Plant Cell. 1995 May;7(5):573-588.
    • Author

    • Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al.
    • Title

    • Small cysteine-rich antifungal proteins from radish: their role in host defense.