General Information

    • DRAMP ID

    • DRAMP00417

    • Peptide Name

    • Raphanus sativus Antifungal Protein 4 (Rs-AFP4; Plant defensin)

    • Source

    • Raphanus sativus (Radish)

    • Family

    • Belongs to the DEFL family

    • Gene

    • AFP4

    • Sequence

    • QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Protein inferred from homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicicola (MIC=5 µg/ml), Botrytis cinerea (MIC=9 µg/ml), Fusarium culmorum (MIC=11 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization of a N-terminal glutamine (Conversion to pyrrolidone carboxylic acid)

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys4 and Cys51, Cys15 and Cys36, Cys21 and Cys45, Cys25 and Cys47.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00417 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00417.

Physicochemical Information

    • Formula

    • C243H367N75O72S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5747.53

    • PI

    • 8.51

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -90.82

    • Hydrophobicity

    • -0.433

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 209.4

    • Polar Residues

    • 27

DRAMP00417

DRAMP00417 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 4-51;15-36;21-45;25-47, and Pyrrolidone carboxylic acid at position 1.

Literature Information

  • ·Literature 1

    • Title

    • Small cysteine-rich antifungal proteins from radish: their role in host defense.

    • Reference

    • Plant Cell. 1995 May;7(5):573-588.

    • Author

    • Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al.