• DRAMP ID

    • DRAMP00418
    • Peptide Name

    • Hc-AFP4 (Plant defensin)
    • Source

    • Heliophila coronopifolia (South African Brassicaceae species)
    • Family

    • Not found
    • Gene

    • Hc-AFP4
    • Sequence

    • QKLCERPSGTWSGVCGNNGACRNQCIRLERARHGSCNYVFPAHKCICYFPC
    • Sequence Length

    • 51
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Botrytis cinerea (IC50=15-20 µg/ml), Fusarium solani (IC50=5-10 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00418 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00418.
    • Formula

    • C242H375N79O68S8
    • Absent Amino Acids

    • DM
    • Common Amino Acids

    • C
    • Mass

    • 5735.61
    • PI

    • 8.94
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +7
    • Boman Index

    • -102.91
    • Hydrophobicity

    • -0.433
    • Aliphatic Index

    • 47.84
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 179.6
    • Polar Residues

    • 23

DRAMP00418

DRAMP00418 chydropathy plot
    • Function

    • Has antifungal activity.
    • PTM

    • Contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Four plant defensins from an indigenous South African Brassicaceae species display divergent activities against two test pathogens despite high sequence similarity in the encoding genes.
    • Reference

    • BMC Res Notes. 2011 Oct 28;4:459.
    • Author

    • de Beer A, Vivier MA.