General Information

    • DRAMP ID

    • DRAMP00419

    • Peptide Name

    • Hc-AFP3 (Plant defensin)

    • Source

    • Heliophila coronopifolia (South African Brassicaceae species)

    • Family

    • Not found

    • Gene

    • Hc-AFP3

    • Sequence

    • RYCERSSGTWSGVCGNTDKCSSQCQRLEGAAHGSCNYVFPAHKCICYYPC

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=20-25 µg/ml), Fusarium solani (IC50>25 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00419 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00419.

Physicochemical Information

    • Formula

    • C231H346N70O73S8

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • C

    • Mass

    • 5528.19

    • PI

    • 8.2

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +4

    • Boman Index

    • -94.38

    • Hydrophobicity

    • -0.496

    • Aliphatic Index

    • 33.2

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11960

    • Absorbance 280nm

    • 244.08

    • Polar Residues

    • 27

DRAMP00419

DRAMP00419 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity.

    • PTM

    • Contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Four plant defensins from an indigenous South African Brassicaceae species display divergent activities against two test pathogens despite high sequence similarity in the encoding genes.

    • Reference

    • BMC Res Notes. 2011 Oct 28;4:459.

    • Author

    • de Beer A, Vivier MA.