General Information

    • DRAMP ID

    • DRAMP00420

    • Peptide Name

    • Hc-AFP2 (Plant defensin)

    • Source

    • Heliophila coronopifolia (South African Brassicaceae species)

    • Family

    • Not found

    • Gene

    • Hc-AFP2

    • Sequence

    • QKLCERPSGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=10-15 µg/ml), Fusarium solani (IC50=10-15 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00420 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00420.

Physicochemical Information

    • Formula

    • C242H372N76O70S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5722.56

    • PI

    • 8.73

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -92.84

    • Hydrophobicity

    • -0.463

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 24

DRAMP00420

DRAMP00420 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity.

    • PTM

    • Contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Four plant defensins from an indigenous South African Brassicaceae species display divergent activities against two test pathogens despite high sequence similarity in the encoding genes.

    • Reference

    • BMC Res Notes. 2011 Oct 28;4:459.

    • Author

    • de Beer A, Vivier MA.