• DRAMP ID

    • DRAMP00422
    • Peptide Name

    • Defensin-like protein 1 (Sa-AFP1; Plant defensin)
    • Source

    • Sinapis alba (White mustard) (Brassica hirta)
    • Family

    • Unknow
    • Gene

    • Unknow
    • Sequence

    • QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
    • Sequence Length

    • 51
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal
    • Target Organism

      • Fungi: Alternaria brassicola (MIC=1.2 µg/ml), Botrytis cinerea (MIC=1.8 µg/ml), Fusarium culmorum (MIC=4 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=6 µg/ml), Pyricularia oryzae (MIC=0.5 µg/ml), Verticillium dahliae (MIC=1.5 µg/ml).
      • NOTE: In synthetic low ionic strength fungal growth medium.
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Bridge
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00422 helical wheel diagram
    • Formula

    • C242H372N74O70S8
    • Absent Amino Acids

    • DM
    • Common Amino Acids

    • C
    • Mass

    • 6586.59
    • PI

    • 8.41
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -83.47
    • Hydrophobicity

    • -45.1
    • Aliphatic Index

    • 47.84
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 179.6
    • Polar Residues

    • 24

DRAMP00422

DRAMP00422 chydropathy plot
    • Function

    • Possesses antifungal activity sensitive to inorganic cations.
  • Literature 1
    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.
    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.
  • Literature 2
    • Reference

    • Int J Pept Protein Res. 1996 Jun;47(6):437-446.
    • Author

    • Neumann GM, Condron R, Polya GM.
    • Title

    • Purification and mass spectrometry-based sequencing of yellow mustard (Sinapis alba L.) 6 kDa proteins. Identification as antifungal proteins.