General Information

    • DRAMP ID

    • DRAMP00424

    • Peptide Name

    • Br-AFP1 (Defensin 1.2; Plant defensin)

    • Source

    • Brassica rapa subsp. Chinensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYVFPYHRCICYFPC

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00424 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00424.

Physicochemical Information

    • Formula

    • C237H357N73O70S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5605.37

    • PI

    • 8.51

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -86.16

    • Hydrophobicity

    • -0.378

    • Aliphatic Index

    • 46.8

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 213.67

    • Polar Residues

    • 27

DRAMP00424

DRAMP00424 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
  • ·Literature 2

    • Title

    • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

    • Reference

    • FEBS Lett. 1995 Jul 17;368(2):257-262.

    • Author

    • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.