General Information

    • DRAMP ID

    • DRAMP00426

    • Peptide Name

    • Defensin-like protein 1 (Hs-AFP1; Plant defensin)

    • Source

    • Heuchera sanguinea (Coralbells)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC

    • Sequence Length

    • 54

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=6 µg/ml), Cladosporium sphaerospermum (IC50=1 µg/ml), Fusarium culmorum (IC50=1 µg/ml), Leptosphaeria maculans (IC50=25 µg/ml), Penicillium digitatum (IC50=1µg/ml), Trichoderma viride (IC50=15 µg/ml), Septoria tritiei (IC50=0.5 µg/ml), Verticillium albo-atrum (IC50=0.5 µg/ml), Neurospora crassa (IC50=12 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • chitin, mannan, galactocerebrosides, and sphingomyelin (Mycopathologia. 1998-1999;144:87-91)

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00426 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00426.

Physicochemical Information

    • Formula

    • C251H378N76O77S8

    • Absent Amino Acids

    • IMN

    • Common Amino Acids

    • CS

    • Mass

    • 5948.71

    • PI

    • 8.49

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -105.54

    • Hydrophobicity

    • -0.613

    • Aliphatic Index

    • 27.04

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 169.43

    • Polar Residues

    • 24

DRAMP00426

DRAMP00426 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity insensitive to inorganic cations. Causes germ tubes and hyphae to swell and form multiple hyphal buds. Binds to the plasma membrane of the fungus. Has no inhibitory effect on insect gut alpha-amylase.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

    • Reference

    • FEBS Lett. 1995 Jul 17;368(2):257-262.

    • Author

    • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.
  • ·Literature 2

    • Title

    • Specific, high affinity binding sites for an antifungal plant defensin on Neurospora crassa hyphae and microsomal membranes.

    • Reference

    • J Biol Chem. 1997 Dec 19;272(51):32176-32181.

    • Author

    • Thevissen K, Osborn RW, Acland DP, Broekaert WF.
  • ·Literature 3

    • Title

    • Fungicidal and binding properties of three plant peptides.

    • Reference

    • Mycopathologia. 1998-1999;144(2):87-91.

    • Author

    • De Lucca AJ, Jacks TJ, Broekaert WJ.