• • DRAMP ID

  • DRAMP00429

• • Peptide Name

  • Aesculus hippocastanum antimicrobial protein 1 (Ah-AMP1; Cys-rich; Plant defensin)

• • Source

  • Aesculus hippocastanum (Horse chestnut)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC

• • Sequence Length

  • 50

• • UniProt Entry

  • Q7M1F3

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

• • Target Organism

  • • Gram-positive bacterium: Bacillus subtilis (IC50=100 µg/mL).
    • Fungi: [MA: Botrytis cinerea (IC50=25 µg/mL), Cladosporium sphaerospermum (IC50=0.5 µg/mL), Fusarium culmorum (IC50=12 µg/mL), Leptosphaeria maculans (IC50=0.5 µg/mL), Penicillium digitatum (IC50=6 µg/mL), Trichoderma viride (IC50>100 µg/mL), Septoria tritiei (IC50=0.5 µg/mL), Verticilium albo-atrum (IC50=6 µg/mL). MA+: Botrytis cinerea (IC50>100 µg/mL), Cladosporium sphaerospermum (IC50=12 µg/mL), Fusarium culmorum (IC50>100 µg/mL), Leptosphaeria maculans (IC50=6 µg/mL), Penicillium digitatum (IC50=25 µg/mL), Trichoderma viride (IC50>100 µg/mL), Septoria tritiei (IC50=1.5 µg/mL), Verticilium albo-atrum (IC50>100 µg/mL)].
    • NOTE: MA+ = MA supplemented with 1 mM CaCl2 and 50 mM KCl.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Binds specifically to the fungal plasma membrane.

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Combine helix and strand structure

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 1BK8 resolved by NMR.

• Predicted Structure

• There is no predicted structure for DRAMP00429.

DRAMP00429

• • Function

  • Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase.

• • PTM

  • Contains four disulfide bonds 2-50; 14-35; 20-44; 24-46 (By similarity).

• ·Literature 1

• • Title

  • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

• • Pubmed ID

  • 7628617

• • Reference

  • FEBS Lett. 1995 Jul 17;368(2):257-262.

• • Author

  • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.

• ·Literature 2

• • Title

  • The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance.

• • Pubmed ID

  • 10591099

• • Reference

  • Proteins. 1999 Nov 15;37(3):388-403.

• • Author

  • Fant F, Vranken WF, Borremans FA.

• ·Literature 3

• • Title

  • Specific binding sites for an antifungal plant defensin from Dahlia (Dahlia merckii) on fungal cells are required for antifungal activity.

• • Pubmed ID

  • 10656585

• • Reference

  • Mol Plant Microbe Interact. 2000 Jan;13(1):54-61.

• • Author

  • Thevissen K, Osborn RW, Acland DP, Broekaert WF.