• DRAMP ID

    • DRAMP00429
    • Peptide Name

    • Aesculus hippocastanum antimicrobial protein 1 (Ah-AMP1; Cys-rich; Plant defensin)
    • Source

    • Aesculus hippocastanum (Horse chestnut)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
    • Sequence Length

    • 50
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Gram-positive bacterium:
        Target OrganismActivity
        Bacillus subtilisIC50=100 µg/mL
      • Fungi:
        Target OrganismActivity
        [MA: Botrytis cinereaIC50=25 µg/mL
        Cladosporium sphaerospermumIC50=0.5 µg/mL
        Fusarium culmorumIC50=12 µg/mL
        Leptosphaeria maculansIC50=0.5 µg/mL
        Penicillium digitatumIC50=6 µg/mL
        Trichoderma virideIC50>100 µg/mL
        Septoria tritieiIC50=0.5 µg/mL
        Verticilium albo-atrum (IC50=6 µg/mL). MA+: Botrytis cinereaIC50>100 µg/mL
        Cladosporium sphaerospermumIC50=12 µg/mL
        Fusarium culmorumIC50>100 µg/mL
        Leptosphaeria maculansIC50=6 µg/mL
        Penicillium digitatumIC50=25 µg/mL
        Trichoderma virideIC50>100 µg/mL
        Septoria tritieiIC50=1.5 µg/mL
        Verticilium albo-atrum (IC50>100 µg/mL)]-
      • NOTE:
        Target OrganismActivity
        MA+ = MA supplemented with 1 mM CaCl2 and 50 mM KCl-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Binds specifically to the fungal plasma membrane.
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00429 helical wheel diagram
    • PDB ID

    • 1BK8 resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP00429.
    • Formula

    • C245H355N79O75S8
    • Absent Amino Acids

    • IMV
    • Common Amino Acids

    • C
    • Mass

    • 5863.48
    • PI

    • 7.73
    • Basic Residues

    • 10
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +5
    • Boman Index

    • -137.49
    • Hydrophobicity

    • -1.174
    • Aliphatic Index

    • 13.8
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 18490
    • Absorbance 280nm

    • 377.35
    • Polar Residues

    • 22

DRAMP00429

DRAMP00429 chydropathy plot
    • Function

    • Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase.
    • PTM

    • Contains four disulfide bonds 2-50; 14-35; 20-44; 24-46 (By similarity).
  • ·Literature 1
    • Title

    • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.
    • Reference

    • FEBS Lett. 1995 Jul 17;368(2):257-262.
    • Author

    • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.
  • ·Literature 2
    • Title

    • The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance.
    • Reference

    • Proteins. 1999 Nov 15;37(3):388-403.
    • Author

    • Fant F, Vranken WF, Borremans FA.
  • ·Literature 3
    • Title

    • Specific binding sites for an antifungal plant defensin from Dahlia (Dahlia merckii) on fungal cells are required for antifungal activity.
    • Reference

    • Mol Plant Microbe Interact. 2000 Jan;13(1):54-61.
    • Author

    • Thevissen K, Osborn RW, Acland DP, Broekaert WF.