• DRAMP ID

    • DRAMP00431
    • Peptide Name

    • Defensin-like protein 2 (Cp-thionin II; Cp-thionin-2; Gamma-thionin II; Plant defensin)
    • Source

    • Vigna unguiculata (Cowpea)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC
    • Sequence Length

    • 46
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus ATTC 25923 (MIC=128 mg/ml);
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli ATTC 25922MIC=64 mg/ml
        Pseudomonas syringaeMIC=42 mg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization of a C-terminal Cys residue (forming a disulfide bond)
    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys3 and Cys46, Cys13 and Cys33, Cys19 and Cys40, Cys23 and Cys42
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00431 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00431.
    • Formula

    • C218H356N68O62S10
    • Absent Amino Acids

    • FPV
    • Common Amino Acids

    • C
    • Mass

    • 5242.24
    • PI

    • 9.2
    • Basic Residues

    • 10
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +8
    • Boman Index

    • -87.15
    • Hydrophobicity

    • -0.439
    • Aliphatic Index

    • 44.57
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 232.67
    • Polar Residues

    • 24

DRAMP00431

DRAMP00431 chydropathy plot
    • Function

    • Has antibacterial activity against the Gram-positive bacterium S. aureus and the Gram-negative bacteria E. coli and P. syringae. Does not have antibacterial activity against the phytopathogenic bacteria R. solanacearum, Rhataybacter sp and Erwinia sp. Does not inhibit trypsin, chymotrypsin or alpha-amylases.
    • Tissue specificity

    • Present in seeds, cotyledons and leaves. Not found in roots or stems.
    • Developmental stage

    • Present in seeds and seedlings, levels decrease with seedling age. Light increases the rate of degradation. Present until 9 days in seedlings kept in the dark, not found after 6 days in seedings kept in the light.
    • PTM

    • Contains four disulfide bonds 3-46; 13-33; 19-40; 23-42.
  • ·Literature 1
    • Title

    • Identification of a cowpea gamma-thionin with bactericidal activity.
    • Reference

    • FEBS J. 2006 Aug;273(15):3489-3497.
    • Author

    • Franco OL, Murad AM, Leite JR, Mendes PA, Prates MV, Bloch C Jr.