• • DRAMP ID

  • DRAMP00431

• • Peptide Name

  • Defensin-like protein 2 (Cp-thionin II; Cp-thionin-2; Gamma-thionin II; Plant defensin)

• • Source

  • Vigna unguiculata (Cowpea)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC

• • Sequence Length

  • 46

• • UniProt Entry

  • P84920

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacterium: Staphylococcus aureus ATTC 25923 (MIC=128 mg/ml);
    • Gram-negative bacteria: Escherichia coli ATTC 25922 (MIC=64 mg/ml), Pseudomonas syringae (MIC=42 mg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Cyclization of a C-terminal Cys residue (forming a disulfide bond)

• • Nonterminal Modifications and Unusual Amino Acids

  • There are four disulfide bonds between Cys3 and Cys46, Cys13 and Cys33, Cys19 and Cys40, Cys23 and Cys42

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00431.

DRAMP00431

• • Function

  • Has antibacterial activity against the Gram-positive bacterium S. aureus and the Gram-negative bacteria E. coli and P. syringae. Does not have antibacterial activity against the phytopathogenic bacteria R. solanacearum, Rhataybacter sp and Erwinia sp. Does not inhibit trypsin, chymotrypsin or alpha-amylases.

• • Tissue specificity

  • Present in seeds, cotyledons and leaves. Not found in roots or stems.

• • Developmental stage

  • Present in seeds and seedlings, levels decrease with seedling age. Light increases the rate of degradation. Present until 9 days in seedlings kept in the dark, not found after 6 days in seedings kept in the light.

• • PTM

  • Contains four disulfide bonds 3-46; 13-33; 19-40; 23-42.

• ·Literature 1

• • Title

  • Identification of a cowpea gamma-thionin with bactericidal activity.

• • Pubmed ID

  • 16824043

• • Reference

  • FEBS J. 2006 Aug;273(15):3489-3497.

• • Author

  • Franco OL, Murad AM, Leite JR, Mendes PA, Prates MV, Bloch C Jr.