General Information

    • DRAMP ID

    • DRAMP00434

    • Peptide Name

    • Defensin-like protein 1 (Gamma-1-purothionin; Plant defensin)

    • Source

    • Triticum aestivum (Wheat)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Gamma 1-P has a well-defined triple-stranded antiparallel beta-sheet (residues 1-6, 31-34, and 39-47), an alpha-helix (residues 16-28), and the corresponding connecting loops. Three disulfide bridges are located in the hydrophobic core holding together the alpha-helix and the beta-sheet and forming a cysteine-stabilized alpha-helical (CSH) motif.

    • Helical Wheel Diagram

    • DRAMP00434 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00434.

Physicochemical Information

    • Formula

    • C212H347N77O61S9

    • Absent Amino Acids

    • HLTY

    • Common Amino Acids

    • C

    • Mass

    • 5239.11

    • PI

    • 9.49

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +8

    • Boman Index

    • -131.17

    • Hydrophobicity

    • -0.815

    • Aliphatic Index

    • 27.02

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 130.43

    • Polar Residues

    • 20

DRAMP00434

DRAMP00434 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Gamma-Purothionins: amino acid sequence of two polypeptides of a new family of thionins from wheat endosperm.

    • Reference

    • FEBS Lett. 1990 Sep 17;270(1-2):191-194.

    • Author

    • Colilla FJ, Rocher A, Mendez E.
  • ·Literature 2

    • Title

    • Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.

    • Reference

    • Biochemistry. 1993 Jan 19;32(2):715-724.

    • Author

    • Bruix M, Jim©nez MA, Santoro J, Gonz¡lez C, Colilla FJ, M©ndez E, Rico M.