General Information

    • DRAMP ID

    • DRAMP00435

    • Peptide Name

    • Defensin-like protein 2 (Gamma-2-purothionin; Plant defensin)

    • Source

    • Triticum aestivum (Wheat)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KVCRQRSAGFKGPCVSDKNCAQVCLQEGWGGGNCDGPFRRCKCIRQC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00435 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00435.

Physicochemical Information

    • Formula

    • C211H343N73O62S8

    • Absent Amino Acids

    • HMTY

    • Common Amino Acids

    • C

    • Mass

    • 5150.98

    • PI

    • 9.12

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -112.6

    • Hydrophobicity

    • -0.596

    • Aliphatic Index

    • 39.36

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 130.43

    • Polar Residues

    • 19

DRAMP00435

DRAMP00435 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Gamma-Purothionins: amino acid sequence of two polypeptides of a new family of thionins from wheat endosperm.

    • Reference

    • FEBS Lett. 1990 Sep 17;270(1-2):191-194.

    • Author

    • Colilla FJ, Rocher A, Mendez E.