• DRAMP ID

    • DRAMP00436
    • Peptide Name

    • Pisum sativum defensin 1 (Psd1; Plant defensin)
    • Source

    • Pisum sativum (Garden pea)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknow
    • Sequence

    • KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
    • Sequence Length

    • 46
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal
    • Target Organism

      • PD: Aspergillus niger (MIC=12.1 µg/ml), Aspergillus versicolor (MIC<5.0 µg/ml), Fusarium moniliforme (MIC=21.7 µg/ml), Fusarium oxysporum (MIC>100 µg/ml), Fusarium solani (MIC=12.1 µg/ml), Neurospora crassa (MIC=0.04 µg/ml), Saccharomyces cerevisae (MIC>100 µg/ml), Trichophyton mentagrophytes (MIC>100 µg/ml).
      • PD+: Aspergillus niger (MIC=7.4 µg/ml), Fusarium moniliforme (MIC=33.2 µg/ml), Fusarium oxysporum (MIC=100 µg/ml), Fusarium solani (MIC=79.2 µg/ml), Neurospora crassa (MIC=0.05 µg/ml).
      • NOTE: PD+: potato dextrose medium supplemented with 1 mM CaCl2.
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • It interacts with cell-cycle-realted protein cyclin F as the target.
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • The protein has a globular fold with a triple-stranded antiparalell beta-sheet and an alpha-helix (from residue Asn17 to Leu27).
    • PDB ID

    • 1JKZ resolved by NMR.
    • DRAMP00436 helical wheel diagram
    • 1JKZ-> 
    • Formula

    • C216H329N67O68S8
    • Absent Amino Acids

    • MP
    • Common Amino Acids

    • C
    • Mass

    • 6011.76
    • PI

    • 7.71
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -95.98
    • Hydrophobicity

    • -54.78
    • Aliphatic Index

    • 38.26
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 166.44
    • Polar Residues

    • 22

Amino Acid Distribution

DRAMP00436 chydropathy plot
    • PTM

    • Contains four disulfide bonds 3-46; 14-35; 20-40; 24-42.
  • Literature 1
    • Reference

    • Arch Biochem Biophys. 2000 Jun 15;378(2):278-286.
    • Author

    • Almeida M.S, Cabral K.M, Zingali R.B, Kurtenbach E.
    • Title

    • Characterization of two novel defense peptides from pea (Pisum sativum) seeds.
  • Literature 2
    • Reference

    • Arch Biochem Biophys. 2001 Nov 15;395(2):199-207.
    • Author

    • Almeida MS, Cabral KS, de Medeiros LN, Valente AP, Almeida FC, Kurtenbach E.
    • Title

    • cDNA cloning and heterologous expression of functional cysteine-rich antifungal protein Psd1 in the yeast Pichia pastoris.
  • Literature 3
    • Reference

    • J Mol Biol. 2002 Jan 25;315(4):749-757.
    • Author

    • Almeida MS, Cabral KM, Kurtenbach E, Almeida FC, Valente AP.
    • Title

    • Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.