General Information

    • DRAMP ID

    • DRAMP00436

    • Peptide Name

    • Pisum sativum defensin 1 (Psd1; Plant defensin)

    • Source

    • Pisum sativum (Garden pea)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • PD: Aspergillus niger (MIC=12.1 µg/ml), Aspergillus versicolor (MIC<5.0 µg/ml), Fusarium moniliforme (MIC=21.7 µg/ml), Fusarium oxysporum (MIC>100 µg/ml), Fusarium solani (MIC=12.1 µg/ml), Neurospora crassa (MIC=0.04 µg/ml), Saccharomyces cerevisae (MIC>100 µg/ml), Trichophyton mentagrophytes (MIC>100 µg/ml).
      • PD+: Aspergillus niger (MIC=7.4 µg/ml), Fusarium moniliforme (MIC=33.2 µg/ml), Fusarium oxysporum (MIC=100 µg/ml), Fusarium solani (MIC=79.2 µg/ml), Neurospora crassa (MIC=0.05 µg/ml).
      • NOTE: PD+: potato dextrose medium supplemented with 1 mM CaCl2.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • It interacts with cell-cycle-realted protein cyclin F as the target.

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization of a C-terminal Cys residue (forming a disulfide bond)

    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys3 and Cys46, Cys14 and Cys35, Cys20 and Cys40, Cys24 and Cys42

    • Stereochemistry

    • L

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The protein has a globular fold with a triple-stranded antiparalell beta-sheet and an alpha-helix (from residue Asn17 to Leu27).

    • Helical Wheel Diagram

    • DRAMP00436 helical wheel diagram

    • PDB ID

    • 1JKZ resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00436.

Physicochemical Information

    • Formula

    • C216H329N67O68S8

    • Absent Amino Acids

    • MP

    • Common Amino Acids

    • C

    • Mass

    • 5208.88

    • PI

    • 7.73

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -95.98

    • Hydrophobicity

    • -0.548

    • Aliphatic Index

    • 38.26

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 166.44

    • Polar Residues

    • 22

DRAMP00436

DRAMP00436 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 3-46; 14-35; 20-40; 24-42.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of two novel defense peptides from pea (Pisum sativum) seeds.

    • Reference

    • Arch Biochem Biophys. 2000 Jun 15;378(2):278-286.

    • Author

    • Almeida M.S, Cabral K.M, Zingali R.B, Kurtenbach E.
  • ·Literature 2

    • Title

    • cDNA cloning and heterologous expression of functional cysteine-rich antifungal protein Psd1 in the yeast Pichia pastoris.

    • Reference

    • Arch Biochem Biophys. 2001 Nov 15;395(2):199-207.

    • Author

    • Almeida MS, Cabral KS, de Medeiros LN, Valente AP, Almeida FC, Kurtenbach E.
  • ·Literature 3

    • Title

    • Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.

    • Reference

    • J Mol Biol. 2002 Jan 25;315(4):749-757.

    • Author

    • Almeida MS, Cabral KM, Kurtenbach E, Almeida FC, Valente AP.