• DRAMP ID

    • DRAMP00438
    • Peptide Name

    • Defensin-like protein 1 (Gamma-thionin 1; Plant defensin)
    • Source

    • Nicotiana paniculata
    • Family

    • Belongs to the DEFL family
    • Gene

    • THIO1
    • Sequence

    • KSTCKAESNTFPGLCITKPPCRKACLSEKFTDGKCSKILRRCICYKPCVFDGKMIQTGAENLAEEAETLAAALLEEEMMDN
    • Sequence Length

    • 81
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00438 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00438.
    • Formula

    • C380H625N103O121S11
    • Absent Amino Acids

    • HW
    • Common Amino Acids

    • EKAC
    • Mass

    • 8925.42
    • PI

    • 6.44
    • Basic Residues

    • 12
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 23
    • Net Charge

    • 0
    • Boman Index

    • -134.15
    • Hydrophobicity

    • -0.296
    • Aliphatic Index

    • 66.42
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 24.88
    • Polar Residues

    • 26

DRAMP00438

DRAMP00438 chydropathy plot
    • PTM

    • Contains four disulfide bonds 4-48; 15-35; 21-42; 25-44.
  • ·Literature 1
    • Title

    • A cDNA clone for gamma-thionin from Nicotiana paniculata.
    • Reference

    • Plant Gene Register PGR97-132.
    • Author

    • Komori T, Yamada S, Imaseki H.