• DRAMP ID

    • DRAMP00443
    • Peptide Name

    • Defensin Tk-AMP-D2 (Plant defensin)
    • Source

    • Triticum kiharae (Wheat)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • RTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNQHHVERKCYCERSC
    • Sequence Length

    • 49
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00443 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00443.
    • Formula

    • C231H359N79O75S8
    • Absent Amino Acids

    • ILMW
    • Common Amino Acids

    • C
    • Mass

    • 5699.36
    • PI

    • 8.51
    • Basic Residues

    • 11
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +6
    • Boman Index

    • -171.63
    • Hydrophobicity

    • -1.125
    • Aliphatic Index

    • 13.88
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 41.46
    • Polar Residues

    • 22

DRAMP00443

DRAMP00443 chydropathy plot
    • Function

    • Plant defense peptide (By similarity).
    • PTM

    • Contains four disulfide bonds 3-49; 14-34; 20-43; 24-45 (By similarity).
  • ·Literature 1
    • Title

    • Seed defensins from T. kiharae and related species: genome localization of defensin-encoding genes.
    • Reference

    • Biochimie. 2007 May;89(5):605-612.
    • Author

    • Odintsova TI, Egorov TA, Musolyamov AKh, Odintsova MS, Pukhalsky VA, Grishin EV.