General Information

    • DRAMP ID

    • DRAMP00443

    • Peptide Name

    • Defensin Tk-AMP-D2 (Plant defensin)

    • Source

    • Triticum kiharae (Wheat)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNQHHVERKCYCERSC

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00443 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00443.

Physicochemical Information

    • Formula

    • C231H359N79O75S8

    • Absent Amino Acids

    • ILMW

    • Common Amino Acids

    • C

    • Mass

    • 5699.36

    • PI

    • 8.51

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +6

    • Boman Index

    • -171.63

    • Hydrophobicity

    • -1.125

    • Aliphatic Index

    • 13.88

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 41.46

    • Polar Residues

    • 22

DRAMP00443

DRAMP00443 chydropathy plot

Comments Information

    • Function

    • Plant defense peptide (By similarity).

    • PTM

    • Contains four disulfide bonds 3-49; 14-34; 20-43; 24-45 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Seed defensins from T. kiharae and related species: genome localization of defensin-encoding genes.

    • Reference

    • Biochimie. 2007 May;89(5):605-612.

    • Author

    • Odintsova TI, Egorov TA, Musolyamov AKh, Odintsova MS, Pukhalsky VA, Grishin EV.