General Information

    • DRAMP ID

    • DRAMP00451

    • Peptide Name

    • Defensin-like protein 2B (AFP2b; M2B; Plant defensin)

    • Source

    • Sinapis alba (White mustard)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • QKLCARPSGTWSSGNCRNNNACRNFCIKLEKSRHGSCNIPFPSNKCICYFPC

    • Sequence Length

    • 52

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00451 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00451.

Physicochemical Information

    • Formula

    • C247H387N79O71S8

    • Absent Amino Acids

    • DMV

    • Common Amino Acids

    • CN

    • Mass

    • 5855.76

    • PI

    • 9.27

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +8

    • Boman Index

    • -115.93

    • Hydrophobicity

    • -0.587

    • Aliphatic Index

    • 41.35

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 146.86

    • Polar Residues

    • 26

DRAMP00451

DRAMP00451 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity sensitive to inorganic cations.

    • Subunit structure

    • Forms oligomers in its native state.

    • PTM

    • Contains four disulfide bonds 4-52; 16-37; 22-46; 26-48 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Purification and mass spectrometry-based sequencing of yellow mustard (Sinapis alba L.) 6 kDa proteins. Identification as antifungal proteins.

    • Reference

    • Int J Pept Protein Res. 1996 Jun;47(6):437-446.

    • Author

    • Neumann GM, Condron R, Polya GM.