• DRAMP ID

    • DRAMP00451
    • Peptide Name

    • Defensin-like protein 2B (AFP2b; M2B; Plant defensin)
    • Source

    • Sinapis alba (White mustard)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • QKLCARPSGTWSSGNCRNNNACRNFCIKLEKSRHGSCNIPFPSNKCICYFPC
    • Sequence Length

    • 52
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00451 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00451.
    • Formula

    • C247H387N79O71S8
    • Absent Amino Acids

    • DMV
    • Common Amino Acids

    • CN
    • Mass

    • 5855.76
    • PI

    • 9.27
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +8
    • Boman Index

    • -115.93
    • Hydrophobicity

    • -0.587
    • Aliphatic Index

    • 41.35
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 146.86
    • Polar Residues

    • 26

DRAMP00451

DRAMP00451 chydropathy plot
    • Function

    • Possesses antifungal activity sensitive to inorganic cations.
    • Subunit structure

    • Forms oligomers in its native state.
    • PTM

    • Contains four disulfide bonds 4-52; 16-37; 22-46; 26-48 (By similarity).
  • ·Literature 1
    • Title

    • Purification and mass spectrometry-based sequencing of yellow mustard (Sinapis alba L.) 6 kDa proteins. Identification as antifungal proteins.
    • Reference

    • Int J Pept Protein Res. 1996 Jun;47(6):437-446.
    • Author

    • Neumann GM, Condron R, Polya GM.