General Information

    • DRAMP ID

    • DRAMP00452

    • Peptide Name

    • Defensin J1-1 (Plant defensin)

    • Source

    • Capsicum annuum (Bell pepper)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum, Botrytis cinerea.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00452 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00452.

Physicochemical Information

    • Formula

    • C217H350N66O66S8

    • Absent Amino Acids

    • HMWY

    • Common Amino Acids

    • C

    • Mass

    • 5196.05

    • PI

    • 8.52

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -79.97

    • Hydrophobicity

    • 0.008

    • Aliphatic Index

    • 58.96

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 10.64

    • Polar Residues

    • 22

DRAMP00452

DRAMP00452 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed in orange and red ripe fruit and to a lesser extent in mature, green fruit. Present in trace in young, green fruit.

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Fruit-specific expression of a defensin-type gene family in bell pepper. Upregulation during ripening and upon wounding.

    • Reference

    • Plant Physiol. 1996 Oct;112(2):615-622.

    • Author

    • Meyer B, Houln© G, Pozueta-Romero J, Schantz ML, Schantz R.