General Information

    • DRAMP ID

    • DRAMP00454

    • Peptide Name

    • Petunia hybrida defensin 1 (PhD1; Cys-rich; Plant defensin)

    • Source

    • Petunia hybrida (Petunia)

    • Family

    • Belongs to the DEFL family

    • Gene

    • D1

    • Sequence

    • ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC

    • Sequence Length

    • 47

    • Evidence code

    • Protein level

Activity Information

    • Biological Activity

    • Antifungal, Antimicrobial

    • Target Organism

      • Fungi: Fusarium oxysporum (MIC=10 µg/ml), Botrytis cinerea (MIC=10 µg/ml).

    • Hemolytic Activity

      • Not found

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Other Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • PhD1 has the fold of the cysteine-stabilized alphabeta motif, consisting of an alpha-helix and a triple-stranded antiparallel beta-sheet, except that it contains a fifth disulfide bond from the first loop to the alpha-helix.

    • PDB ID

    • 1N4N resolved by NMR.
    • DRAMP00454 helical wheel diagram
    • 1N4N-> 

Physicochemical Information

    • Formula

    • C217H363N65O63S10

    • Absent Amino Acids

    • MQY

    • Common Amino Acids

    • C

    • Mass

    • 6031.98

    • PI

    • 8.58

    • Basic Residues

    • 11

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Boman Index

    • -80.46

    • Hydrophobicity

    • -0.211

    • Aliphatic Index

    • 54.04

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6125

    • Absorbance 280nm

    • 133.15

    • Polar Residues

    • 18

DRAMP00454

DRAMP00454 chydropathy plot

Comments Information

    • Function

    • Plant defense peptide with antifungal activity.

    • Tissue specificity

    • Petals.

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • Biophysicochemical properties

    • pH dependence (Stable under extremes of pH); Temperature dependence (Stable under extremes of temperature).

    • PTM

    • Contains five disulfide bonds 3-47; 7-23; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and properties of floral defensins from ornamental tobacco and petunia.

    • Reference

    • Plant Physiol. 2003 Mar;131(3):1283-1293.

    • Author

    • Lay FT, Brugliera F, Anderson MA.