General Information

    • DRAMP ID

    • DRAMP00456

    • Peptide Name

    • Defensin-like protein 1 (Fabatin-1; Plant defensin)

    • Source

    • Vicia faba (Broad bean)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • LLGRCKVKSNRFHGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Enterococcus hirae;
      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00456 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00456.

Physicochemical Information

    • Formula

    • C213H353N75O61S9

    • Absent Amino Acids

    • AIQW

    • Common Amino Acids

    • C

    • Mass

    • 5229.15

    • PI

    • 9.12

    • Basic Residues

    • 12

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +9

    • Boman Index

    • -110.86

    • Hydrophobicity

    • -0.417

    • Aliphatic Index

    • 53.83

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 43.26

    • Polar Residues

    • 22

DRAMP00456

DRAMP00456 chydropathy plot

Comments Information

    • Function

    • Fabatins have antibacterial activity against Gram-positive and Gram-negative bacteria, but were inactive against the yeasts Saccharomyces cerevisiae and Candida albicans. High activity against P. aeruginosa.

    • PTM

    • Contains four disulfide bonds 5-47; 16-36; 22-43; 26-45.

Literature Information

  • ·Literature 1

    • Title

    • Fabatins: new antimicrobial plant peptides.

    • Reference

    • FEMS Microbiol Lett. 1997 Apr 1;149(1):59-64.

    • Author

    • Zhang Y, Lewis K.