General Information

    • DRAMP ID

    • DRAMP00457

    • Peptide Name

    • Defensin-like protein 1 (LCR68; Plant defensin 2.3; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF2.3

    • Sequence

    • RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC

    • Sequence Length

    • 47

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00457 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00457.

Physicochemical Information

    • Formula

    • C217H342N82O62S8

    • Absent Amino Acids

    • DILMQW

    • Common Amino Acids

    • C

    • Mass

    • 5348.1

    • PI

    • 9.49

    • Basic Residues

    • 14

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +12

    • Boman Index

    • -156.61

    • Hydrophobicity

    • -0.951

    • Aliphatic Index

    • 14.47

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 43.26

    • Polar Residues

    • 24

DRAMP00457

DRAMP00457 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed in the whole plant except roots.

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.

    • Reference

    • Plant Biotechnol J. 2006 May;4(3):317-324.

    • Author

    • Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P.