General Information

    • DRAMP ID

    • DRAMP00462

    • Peptide Name

    • Defensin-like protein 6 (Protein LCR74; Plant defensin 2.5; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF2.5

    • Sequence

    • RTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGGRCHGFHRRCYCTRLC

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00462 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00462.

Physicochemical Information

    • Formula

    • C226H349N81O63S9

    • Absent Amino Acids

    • DPW

    • Common Amino Acids

    • C

    • Mass

    • 5497.3

    • PI

    • 9.3

    • Basic Residues

    • 13

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +12

    • Boman Index

    • -136.8

    • Hydrophobicity

    • -0.706

    • Aliphatic Index

    • 24.89

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 75.65

    • Polar Residues

    • 24

DRAMP00462

DRAMP00462 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 4-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.