General Information

    • DRAMP ID

    • DRAMP00466

    • Peptide Name

    • Defensin-like protein 10 (Protein LCR72; Plant defensin 2.6; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF2.6

    • Sequence

    • RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC

    • Sequence Length

    • 45

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00466 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00466.

Physicochemical Information

    • Formula

    • C190H307N61O65S8

    • Absent Amino Acids

    • DHIMW

    • Common Amino Acids

    • S

    • Mass

    • 4742.38

    • PI

    • 8.74

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -93.43

    • Hydrophobicity

    • -0.387

    • Aliphatic Index

    • 30.44

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 45.23

    • Polar Residues

    • 25

DRAMP00466

DRAMP00466 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.