General Information

    • DRAMP ID

    • DRAMP00470

    • Peptide Name

    • Defensin-like protein 14 (Plant defensin 1.3; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF1.3

    • Sequence

    • QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00470 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00470.

Physicochemical Information

    • Formula

    • C237H362N68O70S8

    • Absent Amino Acids

    • DMR

    • Common Amino Acids

    • C

    • Mass

    • 5540.37

    • PI

    • 8.49

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -55

    • Hydrophobicity

    • -0.306

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 25

DRAMP00470

DRAMP00470 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 4-51;15-36;21-45;25-47, and Pyrrolidone carboxylic acid at position 1.

Literature Information

  • ·Literature 1

    • Title

    • Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.

    • Reference

    • Nature. 1999 Dec 16;402(6763):761-768.

    • Author

    • Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL, Barnstead M, Feldblyum TV, Buell CR, Ketchum KA, Lee J, Ronning CM, Koo HL, Moffat KS, Cronin LA, Shen M, Pai G, Van Aken S, Umayam L, Tallon LJ, Gill JE, Adams MD, Carr