General Information

    • DRAMP ID

    • DRAMP00471

    • Peptide Name

    • Defensin-like protein 15 (Putative plant defensin 1.2b; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF1.2B

    • Sequence

    • QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

    • Sequence Length

    • 51

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00471 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00471.

Physicochemical Information

    • Formula

    • C233H362N68O70S8

    • Absent Amino Acids

    • DMR

    • Common Amino Acids

    • C

    • Mass

    • 5492.33

    • PI

    • 8.49

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -53.94

    • Hydrophobicity

    • -0.278

    • Aliphatic Index

    • 53.53

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 25

DRAMP00471

DRAMP00471 chydropathy plot

Comments Information

    • Function

    • Confers broad-spectrum resistance to pathogens.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 2

    • Title

    • Plant defensins.

    • Reference

    • Planta. 2002 Dec;216(2):193-202.

    • Author

    • Thomma BP, Cammue BP, Thevissen K.