General Information

    • DRAMP ID

    • DRAMP00475

    • Peptide Name

    • Defensin-like protein 19 (Protein LCR78; Plant defensin 1.4; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF1.4

    • Sequence

    • TEMMAVEGRICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC

    • Sequence Length

    • 58

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00475 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00475.

Physicochemical Information

    • Formula

    • C280H418N88O81S10

    • Absent Amino Acids

    • L

    • Common Amino Acids

    • C

    • Mass

    • 6633.54

    • PI

    • 8.5

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +5

    • Boman Index

    • -132.73

    • Hydrophobicity

    • -0.509

    • Aliphatic Index

    • 20.34

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 227.89

    • Polar Residues

    • 24

DRAMP00475

DRAMP00475 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 11-58;22-43;28-52;32-54.

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.