General Information

    • DRAMP ID

    • DRAMP00485

    • Peptide Name

    • Putative defensin-like protein 29 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KSMVEVNAAHKWYIVEGLCSKFPDCNKHCKEQKFPGGTCLKLGVNMMCTCIYS

    • Sequence Length

    • 53

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00485 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00485.

Physicochemical Information

    • Formula

    • C261H411N69O73S9

    • Absent Amino Acids

    • R

    • Common Amino Acids

    • KC

    • Mass

    • 5972.09

    • PI

    • 8.61

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +5

    • Boman Index

    • -47.24

    • Hydrophobicity

    • -0.126

    • Aliphatic Index

    • 62.45

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 170.29

    • Polar Residues

    • 20

DRAMP00485

DRAMP00485 chydropathy plot

Comments Information

    • Caution

    • Lacks 1 of the 4 disulfide bonds, which are conserved features of the family.

Literature Information

  • ·Literature 1

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 2

    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 3. II. Sequence features of the 4,251,695 bp regions covered by 90 P1, TAC and BAC clones.

    • Reference

    • DNA Res. 2000 Jun 30;7(3):217-221.

    • Author

    • Kaneko T, Katoh T, Sato S, Nakamura A, Asamizu E, Tabata S.